Protein Info for Shew_1782 in Shewanella loihica PV-4

Annotation: MarR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF12802: MarR_2" amino acids 35 to 94 (60 residues), 38.4 bits, see alignment E=1.8e-13 PF13463: HTH_27" amino acids 37 to 104 (68 residues), 29.2 bits, see alignment E=1.4e-10 PF01047: MarR" amino acids 37 to 95 (59 residues), 42.9 bits, see alignment E=5.6e-15

Best Hits

Swiss-Prot: 39% identical to SLYA_PECCC: Transcriptional regulator SlyA (slyA) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 100% identity to slo:Shew_1782)

Predicted SEED Role

"Transcriptional regulator SlyA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDV0 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Shew_1782 MarR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MTAENRDWAESSNAERVARLARLWRMVADAELAPLGLTHSRWSVLWKLYRMGQQTSQKDL
AEALEIELASLMRTLSQLEQQALIERHCCEHDKRVRRVSLTQAGLDLLAFIRQRIIDLRA
ELYQGVSPEQLEAFEFVLNRISENAVKKLHPDATDKEEK