Protein Info for Shew_1731 in Shewanella loihica PV-4

Annotation: histidine triad (HIT) protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF11969: DcpS_C" amino acids 5 to 110 (106 residues), 85 bits, see alignment E=5.5e-28 PF01230: HIT" amino acids 12 to 108 (97 residues), 106 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 80% identical to HINT_SHIFL: Purine nucleoside phosphoramidase (hinT) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1731)

MetaCyc: 80% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"YcfF/hinT protein: a purine nucleoside phosphoramidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDQ0 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Shew_1731 histidine triad (HIT) protein (RefSeq) (Shewanella loihica PV-4)
MAEETIFSKIIRREIPADILYQDELVTAFRDIQPKAPTHILIIPNHLIPTVNDVKASDEK
ALGRMMTVAAKLADEAGIAEDGYRLIMNCNKHGGQEVFHIHMHLLGGDFLGPLVSR