Protein Info for Shew_1719 in Shewanella loihica PV-4

Annotation: biotin synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00433: biotin synthase" amino acids 18 to 313 (296 residues), 414.2 bits, see alignment E=1.5e-128 PF04055: Radical_SAM" amino acids 52 to 207 (156 residues), 79.8 bits, see alignment E=2.7e-26 PF06968: BATS" amino acids 223 to 313 (91 residues), 103.4 bits, see alignment E=6.1e-34

Best Hits

Swiss-Prot: 100% identical to BIOB_SHELP: Biotin synthase (bioB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to slo:Shew_1719)

MetaCyc: 71% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDN8 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Shew_1719 biotin synthase (RefSeq) (Shewanella loihica PV-4)
MSELALRHDWQRDEIEALFALPMNDLLFKAHSIHRQHFDPNEVQISRLLSIKTGACPEDC
KYCPQSARYDTGLEKERLIEIEKVLTEARAAKAAGASRFCMGAAWRNPHERDMPYLKDMV
SEVKAMGMETCMTLGMLSESQAKDLADAGLDYYNHNLDTSPEYYGDIITTRTYQDRLNTL
DNVRAAGMKVCSGGIVGMGEQASDRAGLLQQLANMAKHPESVPINMLVKVAGTPFENLDD
LDPLEFVRTIAVARIVMPLSRVRLSAGREKMTDELQAMCFFAGANSIFYGCKLLTTSNPE
ENEDMTLFKRLGLHPEQGKAGTVEEDKAVFAKAQAVKDKASQPFYDAAAL