Protein Info for Shew_1701 in Shewanella loihica PV-4

Annotation: transcriptional regulator PhoU (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 13 to 222 (210 residues), 237.7 bits, see alignment E=5.2e-75 PF01895: PhoU" amino acids 26 to 111 (86 residues), 81.9 bits, see alignment E=1.8e-27 amino acids 128 to 213 (86 residues), 58.9 bits, see alignment E=2.7e-20

Best Hits

Swiss-Prot: 62% identical to PHOU_SHIFL: Phosphate-specific transport system accessory protein PhoU (phoU) from Shigella flexneri

KEGG orthology group: K02039, phosphate transport system protein (inferred from 100% identity to slo:Shew_1701)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDM0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Shew_1701 transcriptional regulator PhoU (RefSeq) (Shewanella loihica PV-4)
MENMNLNKHISGQFNAELDDIRNRVLAMGGLVERQLEQALDALGNLDADLAQKVIDGDHS
VNGMEVSIDEECTRIIAKRQPAASDLRLIIAISKTIADLERIGDACVKIAAAALDKRLKN
QQPLLVSIEHMGRHATRTLHSTLDALARMDADVAIELHKEDSKLDSEYEGIIRQLMTYMM
EDPRSIPEVLDVLWAARAVERVGDRCQNICEYIIYYVKGKDVRHTSYEEMKQI