Protein Info for Shew_1700 in Shewanella loihica PV-4

Annotation: phosphate ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 26 to 272 (247 residues), 426.8 bits, see alignment E=1.1e-132 PF00005: ABC_tran" amino acids 42 to 197 (156 residues), 112.5 bits, see alignment E=3.8e-36 PF13304: AAA_21" amino acids 137 to 227 (91 residues), 27.3 bits, see alignment E=5.9e-10

Best Hits

Swiss-Prot: 93% identical to PSTB1_SHEON: Phosphate import ATP-binding protein PstB 1 (pstB1) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to slo:Shew_1700)

MetaCyc: 60% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDL9 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Shew_1700 phosphate ABC transporter, ATPase subunit (RefSeq) (Shewanella loihica PV-4)
MISIDQSVMKTETLDLNNLSSEQTALEIRNLDLKYGDKQALFDVSMKIPKKKVTAFIGPS
GCGKSTLLRCINRMNDLVDNCNIDGEILLHGQNIYDKKVDVASLRRNVGMVFQRPNPFPK
SIYENVVYGLRLQGINNRRQLDEAAERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIA
RAIAIEPEVLLLDEPTSALDPISTLTIEELITELKAKYTVVIVTHNMQQAARVSDQTAFM
YMGELVEYADTNTIFTTPKKKKTEDYITGRYG