Protein Info for Shew_1681 in Shewanella loihica PV-4

Annotation: diguanylate cyclase with PAS/PAC sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details PF00989: PAS" amino acids 214 to 326 (113 residues), 25.1 bits, see alignment E=2.9e-09 TIGR00229: PAS domain S-box protein" amino acids 215 to 334 (120 residues), 43.5 bits, see alignment E=3.2e-15 PF13426: PAS_9" amino acids 223 to 329 (107 residues), 34.3 bits, see alignment E=4.7e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 334 to 495 (162 residues), 152.8 bits, see alignment E=7.2e-49 PF00990: GGDEF" amino acids 337 to 491 (155 residues), 156.9 bits, see alignment E=7.6e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1681)

Predicted SEED Role

"putative diguanylate cyclase (GGDEF)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDK0 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Shew_1681 diguanylate cyclase with PAS/PAC sensor (RefSeq) (Shewanella loihica PV-4)
MHHPFKPFKIYSLAILYVVFLVGAFSILMASIDQSQRDWKRHTYEALEKTAYFNDAMVAL
GYGGFIHDFKNAVIRQDLSYLRRAETEIELGLDSLQKYLQRAPEHTAEVRAIQSVVSQYR
HNLPKLRQMLEEKQSVADIDRVVRVDDTPAIEAIEAILSSHAQSPNSLFEQAGSAHQRVN
HMLLVILCALVLVSILVFSFIRYVNKRLAIKLKDLEVIFRCAPNAIFSVNEHGTIISANR
ETMRLFGFSERALNKINVDDLVPSATKEKHKKLRLEFQKSDRVQPMSQRNTIFYGKKLNG
DVFPASISIATYGVGDEKHSIVVIKDLSDEMQYKSQANTDPLTKVANRRAINRQLAAAIS
RSNRQQTPLAVCIFDIDHFKAVNDKHGHLVGDDVLQRVAKIFSDAIRKTDFVGRWGGEEF
VIILEDTDKEGAKHFADKLRQEVKRRSQGIDFPVAITLSAGVSVYCQDDKQDCLFNHADQ
ALYRAKESGRDCVVVI