Protein Info for Shew_1652 in Shewanella loihica PV-4

Annotation: putative succinate dehydrogenase, hydrophobic subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 10 to 113 (104 residues), 119.1 bits, see alignment E=4.5e-39 PF01127: Sdh_cyt" amino acids 10 to 101 (92 residues), 36.6 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 64% identical to DHSD_SHIFL: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Shigella flexneri

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 100% identity to slo:Shew_1652)

MetaCyc: 64% identical to succinate:quinone oxidoreductase, membrane protein SdhD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDH1 at UniProt or InterPro

Protein Sequence (115 amino acids)

>Shew_1652 putative succinate dehydrogenase, hydrophobic subunit (RefSeq) (Shewanella loihica PV-4)
MVTNAASLGRSGVHDFILLRASAVILTCYTIFLVGFIAASAPLTYDVWHGLFSALPMKVF
TLLALVAILVHAWIGIWQVLTDYVKPVAVRGVLQFVFVVAALSYLAAGIVIVWGV