Protein Info for Shew_1622 in Shewanella loihica PV-4

Annotation: pyridoxamine 5'-phosphate oxidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 3 to 218 (216 residues), 278.3 bits, E=2e-87
• PF01243: PNPOx_N
  • amino acids 40 to 160 (121 residues), 100 bits, E=1.8e-32
• PF10590: PNP_phzG_C
  • amino acids 173 to 218 (46 residues), 73.6 bits, 1.4e-24

Best Hits

Swiss-Prot: 100% identical to PDXH_SHELP: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to slo:Shew_1622)

MetaCyc: 64% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• pyridoxal 5'-phosphate salvage I (2/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (2/9 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

See A3QDE1 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Shew_1622 pyridoxamine 5'-phosphate oxidase (RefSeq) (Shewanella loihica PV-4)
MSNLSDIRREYTLGGLHREELPDNPMVLFEKWIEQIRDSEILPDPTAMSVATVDAEGQPF
QRIVLLKRFDDNGFVFFTNLASRKAEQIAHNNKVSLLFPWHALERQVAVTGVAEQLSTTE
VLKYFVTRPKESQIAAWVSKQSSKISARQALESKFAEMKAKFSQGEVPLPKFWGGYRVRP
SSIEFWQGGEYRLHDRFLYSRKDSSLKEGGWDIDRLAP