Protein Info for Shew_1621 in Shewanella loihica PV-4

Annotation: agmatinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR01230: agmatinase" amino acids 21 to 299 (279 residues), 292.3 bits, see alignment E=2.2e-91 PF00491: Arginase" amino acids 33 to 298 (266 residues), 294.4 bits, see alignment E=4.8e-92

Best Hits

Swiss-Prot: 66% identical to SPEB_SERP5: Agmatinase (speB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 100% identity to slo:Shew_1621)

MetaCyc: 63% identical to agmatinase (Escherichia coli K-12 substr. MG1655)
Agmatinase. [EC: 3.5.3.11]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDE0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Shew_1621 agmatinase (RefSeq) (Shewanella loihica PV-4)
MTTIADKPDYSLYSNAFGYLRQPLDFKPLESDADVVVIGLPFDMATTGRSGGRMGPGAIR
QASVNLAWEECRWPWDFKLSDHLKMVDAGDLVFDCGDAADFTQRVEDFATAVLDSGKALM
SFGGDHFVTLPLLRAHYKKHGKMALLHFDAHTDTYSQGSKYDHGTMFFHAPNEGIIDASH
SVQVGIRTEYDKPSHLFKVIDAAAANEMTADEIVAQIKDRVGDMPLYVTFDIDCLDPAFA
PGTGTPVCGGLTSDKAMKIIRGLRGMNVVGMDVVEVAPAYDSAEITALAGATLGLEMLHV
WACAHKK