Protein Info for Shew_1608 in Shewanella loihica PV-4

Annotation: carbohydrate kinase, FGGY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF00370: FGGY_N" amino acids 18 to 262 (245 residues), 93.2 bits, see alignment E=2.1e-30 PF02782: FGGY_C" amino acids 324 to 471 (148 residues), 93.6 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1608)

Predicted SEED Role

"Putative novel glycerol kinase, FGGY family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDC7 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Shew_1608 carbohydrate kinase, FGGY (RefSeq) (Shewanella loihica PV-4)
MTLTSTPASSASTGENPYFLALDYGTQSVRALVFDRQGQLVAKRQHAVQPYRDGAPGESE
QSADYCYRQLVDVIRGLFEHTQVLPSQIKGMALTTQRACTVLLDDAGQAISPVYMWSDRR
LASDNLPPMAWYYRLGFFCIGLSRRIAYLRRAAKVNYLLEHQKDRLAAADKVGLLSGYLI
GQITGRLVDSKASQVAYLPFDYRRKAWAHPRSWRWQALACRPSQMVPLTAPTDQLGLVSE
HFAKDSGLTPGLAVYGAGADKACEVYAAGCGEQEIACISLGSAAILAWGGERYREAYRYL
PAFPSIEANDYITEIQLERGFWLLSWLIEQFGAQDVIEASRLGISPEQYITQAIAKVPVG
ADGLLLSPLWAQGVIYPGPEARGSIVGFTPEHGRLHLYRAAIEGILMTLKQGLLCLERLK
GSPFKVVRITGGGAQSDLVMQMCADIFNRPVERLSLHEASGLGAAMCCAVGAGIYPDLAS
ARGQMCRLGEKFEPEAAHVAQYARVFTAFEALYPQIKPFFKKVNRQY