Protein Info for Shew_1596 in Shewanella loihica PV-4

Annotation: diguanylate cyclase with PAS/PAC sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF08448: PAS_4" amino acids 180 to 281 (102 residues), 37.1 bits, see alignment E=3.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 288 to 451 (164 residues), 117.8 bits, see alignment E=4e-38 PF00990: GGDEF" amino acids 291 to 451 (161 residues), 127.2 bits, see alignment E=5.3e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1596)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDB5 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Shew_1596 diguanylate cyclase with PAS/PAC sensor (RefSeq) (Shewanella loihica PV-4)
MTDLEEALALLAAPCIDERFFQRALKALALVTQCRWAAFARPSIHRGKIEVVAFCDVKQT
IPGFEFDLMGSPCEAIYQMRYPNTHLLYANDLQQRFPDFQLIKDLGAVSYQAELILDDEG
GPIGHILVMDTLPQRENTKSREFFRLLAQRIGIEYKRLLMSRELSVHKEMIASTHHMMSF
VGLDYRYHVVSKGYEHLLNCDASEIIGKHASEIHGKAIFETHLKPLLDRSFAGESINTQT
RIHPPSVSEPQYLNVHHNPHQDENGQISGVIVSAHNITELHKAKEQSEYLAFHDSLTQLP
NRLALFNHFAEMLSSQPQSQAELAVLYLDLDDFKLINDNYNHLVGDKVLQKVAEILRKVC
PEAEMVARIGGDEFIILHSFDAQNESDKSRALSTLCLSLNQMLDDGIRHEGDHLRLAASI
GCHWVEPDQRDVSALICLADKSMYRNKRRKRLNEARQ