Protein Info for Shew_1592 in Shewanella loihica PV-4

Annotation: sulphate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 401 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 374 (361 residues), 191.9 bits, see alignment E=1.6e-60 PF01740: STAS" amino acids 412 to 497 (86 residues), 31.7 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1592)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDB1 at UniProt or InterPro

Protein Sequence (519 amino acids)

>Shew_1592 sulphate transporter (RefSeq) (Shewanella loihica PV-4)
MFDLIRHKTSSHRADLLSGLTVALALVPEAVAFAFVAGVEPMVGLYAAFIMGLVTALIGG
RPGMISGATGAMAVVMVALVSEHGVQYLFAAVVLAGLIQVTCGLFKLGKFIRIVPYPVMI
GFVNGLAIVIFLAQLGQFKVPDANGVLTWLPQDQLILMLGLVALTMAIIHFLPKLTTAFP
SSLAAILTVTAIVVYFELDTRNVLDFLKSMSGDEHATIAGNLPSFAIPSVPFNLETLSII
LPYSFILAAVGLIESLLTLTVIDEMTSTRGKGNKECVGQGIGNITSGFFGAMGGCAMIGQ
SMININSGGRGRLSGITAAIALLTFILFGSALIEMIPLAALVGVMFMVVLGTFEWASFKV
MRKVPKHDAFVIVLVTVVTVFTDLAFAVFVGVIVSALVFAWEHAKHINVDVSEDANGWKV
YKLNGPLFFGSVAEFLELFHAKTDPQDVIVDFQNSRVCDHSALEAIDTLAERYVSAGKRL
HLRHLSHDCKKLLHKAGDLVEVNLIEDPHYKVADDKLDS