Protein Info for Shew_1587 in Shewanella loihica PV-4

Annotation: DNA ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF01068: DNA_ligase_A_M" amino acids 75 to 188 (114 residues), 31.4 bits, see alignment E=1.6e-11 PF14743: DNA_ligase_OB_2" amino acids 202 to 267 (66 residues), 111.3 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K01971, DNA ligase (ATP) [EC: 6.5.1.1] (inferred from 100% identity to slo:Shew_1587)

Predicted SEED Role

"DNA ligase (ATP) (EC 6.5.1.1)" (EC 6.5.1.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDA6 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Shew_1587 DNA ligase (RefSeq) (Shewanella loihica PV-4)
MPEQLKSEPLEPAQRLPGIQLAGSLEADRPISEYLVSEKFDGVRGRWTGERMLTRSGQVI
RLPAWFTKGFPTEPLDGELWIARQQFEAISALVRDKDADPERWRAVQFMVFDYPTIDSPF
AERYALAVKRYANLSPFLQIIPQWRIQDSQALNAALDEWVAQGAEGLMLHHQAAHYHAGR
NGDLVKLKRYQDAEAKVIAYFEGKGKYRGMMGALEVETNEGIRFKLGTGFSDEQRRHPPA
IGSTVTYKYYGLTHNGVPRFASFMRVREPL