Protein Info for Shew_1583 in Shewanella loihica PV-4

Name: yebU
Annotation: rRNA (cytosine-C(5)-)-methyltransferase RsmF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17125: Methyltr_RsmF_N
  • amino acids 4 to 96 (93 residues), 81.6 bits, E=1.2e-26
• PF22458: RsmF-B_ferredox
  • amino acids 8 to 72 (65 residues), 27.2 bits, E=8.5e-10
• TIGR00446: NOL1/NOP2/sun family putative RNA methylase
  • amino acids 37 to 307 (271 residues), 309.9 bits, E=6.2e-97
• PF01189: Methyltr_RsmB-F
  • amino acids 117 to 305 (189 residues), 155 bits, E=5.3e-49
• PF21150: YebU_pre-PUA_dom
  • amino acids 326 to 403 (78 residues), 79.4 bits, E=3.7e-26
• PF13636: Methyltranf_PUA
  • amino acids 417 to 466 (50 residues), 49.1 bits, 1.2e-16

Best Hits

Swiss-Prot: 100% identical to RSMF_SHELP: Ribosomal RNA small subunit methyltransferase F (rsmF) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K11392, ribosomal RNA small subunit methyltransferase F [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_1583)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A3QDA2 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Shew_1583 rRNA (cytosine-C(5)-)-methyltransferase RsmF (RefSeq) (Shewanella loihica PV-4)
MVQLNQNFINSIAKDMPDHLSMDEFISYCAKPLRPSIRVNTLKITTADFITMMNAKGWQF
EPVPWCEDGFWVKVDDSVQLGNTVEHIQGLFYIQEASSMLPPKALFPEPIEDATSLTLLD
MASAPGSKTTQLAAMMNNQGLLVANEYSSSRVKVLHANVQRMGASNLALTHFDARVFGKY
LFESFDAILLDAPCGGEGTVRKDPDALKHWDESEIEAIASVQRDLIESAFLALKPGGSLV
YSTCTLNRRENQDVCLHLKATYGDAVQFESLAGLFPGAEKASTSEGFLHVWPQIFDSEGF
FIAKLTKIAAVPRNSEEPRKQKNFPFTPIDKKSRQALCDYFDTSFGIKLDGQGILMQRDD
EFWLFPTNVDPLIGKIRFQRIGLKLADALKKGFKPRHEAVMALADRLRGIPLDEAQAIQY
LMGRDIALTSKEKPQGERLVSYQGAHLGLVKHLGNKLKNSLPRDLVRDKICSSSAMAVDQ
QATGED