Protein Info for Shew_1566 in Shewanella loihica PV-4

Annotation: ATP-dependent Clp protease, ATP-binding subunit clpA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 PF02861: Clp_N" amino acids 2 to 126 (125 residues), 106.1 bits, see alignment E=9.9e-34 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 733 (731 residues), 1090.3 bits, see alignment E=0 PF00004: AAA" amino acids 210 to 313 (104 residues), 45.9 bits, see alignment E=5.2e-15 amino acids 491 to 606 (116 residues), 36.9 bits, see alignment E=3.1e-12 PF07728: AAA_5" amino acids 210 to 288 (79 residues), 23.4 bits, see alignment E=3.5e-08 amino acids 490 to 606 (117 residues), 43.1 bits, see alignment E=2.8e-14 PF17871: AAA_lid_9" amino acids 349 to 452 (104 residues), 92.1 bits, see alignment E=1.2e-29 PF07724: AAA_2" amino acids 485 to 646 (162 residues), 201.6 bits, see alignment E=6.1e-63 PF00158: Sigma54_activat" amino acids 489 to 614 (126 residues), 23.1 bits, see alignment E=3.4e-08 PF10431: ClpB_D2-small" amino acids 652 to 732 (81 residues), 82.7 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 70% identical to CLPA_ECOLI: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli (strain K12)

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to slo:Shew_1566)

MetaCyc: 70% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD85 at UniProt or InterPro

Protein Sequence (752 amino acids)

>Shew_1566 ATP-dependent Clp protease, ATP-binding subunit clpA (RefSeq) (Shewanella loihica PV-4)
MLNKDLEVTLNLAFQQARDARHEYMTVEHLLLALIDNPAAQEALLACGANLDKLREEVSS
FIEQTTPIISDPNDDRETQPTLGFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA
VYLLRNGEITRLDVVNYISHGVSRDELDNAQEPEQIEDHSESEERSKLSQFTANLNEEAR
KGNIDPLIGRSDEIERSIQILCRRRKNNPLLVGEAGVGKTAIAEGLAYRIVNDEVPEVMA
DATVYSLDLGALLAGTKYRGDFEKRFKSLLKELSQDKHAILFIDEIHTIIGAGAASGGVM
DASNLLKPLLSSGHLRCMGSTTFQEYQSIFEKDRALARRFQKVDINEPSVAETTKILQGL
KSKYEEHHGVRYTMAALSVAARLADKHINDRHLPDKAIDVIDEAGARMAMQPASKRKKTI
GQAEIESIIAKIARIPEKTVSATDKDMLKNLERNLKMVVFGQDKAIEALSSAIRLSRSGL
SGAHKPVGSFLFAGPTGVGKTEVTSQLASCLSLKLVRFDMSEYMESHTVSRLIGAPPGYV
GYDQGGLLTDAVIKNPHCVVLLDEIEKAHPDVYNLLLQVMDHGTLTDNNGRKADFRHVTL
VMTTNAGVQETVRKSIGFKQQDHSQDALSEINRVFSPEFRNRLDEIIWFNHLDMTVIAKV
VDKFLVELQAQLDEKSVVLDVSDDARTLLAEKGYDKAMGARPMARVVTEMIKRPLADEIL
FGKLEKGGVAHVDVDGDKLTIKIEQSERLTQA