Protein Info for Shew_1536 in Shewanella loihica PV-4

Annotation: putative chloramphenicol acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 109 to 144 (36 residues), 42.5 bits, 1.7e-15

Best Hits

Swiss-Prot: 71% identical to CAT4_MORMO: Chloramphenicol acetyltransferase (cat) from Morganella morganii

KEGG orthology group: K00638, chloramphenicol O-acetyltransferase [EC: 2.3.1.28] (inferred from 100% identity to slo:Shew_1536)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.28

Sequence Analysis Tools

See A3QD55 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Shew_1536 putative chloramphenicol acetyltransferase (RefSeq) (Shewanella loihica PV-4)
MKNYFDSPFAGQSLKEQVTNPNIIVGEHSYYSGYYHQHSFDDCARYLAPDRDDVDRLIIG
NYCSIGSGAVFMMAGNQGHRSDWVSSFPFFYQQGDSFSGAQDGFVRAGDTLIGNDVWIGS
EAMIMPGVTVGDGAVIASRAVVTKDVPAYAVVGANPAKLIRYRFSDEEVAMLMEMQWWHW
SDDKVKAAMHLLCSKDIAGLYAYWQQTR