Protein Info for Shew_1503 in Shewanella loihica PV-4

Annotation: oxidoreductase FAD-binding subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 193 to 213 (21 residues), see Phobius details PF13510: Fer2_4" amino acids 2 to 45 (44 residues), 28.7 bits, see alignment 2.3e-10 PF00111: Fer2" amino acids 8 to 77 (70 residues), 39.7 bits, see alignment E=7.7e-14 PF00970: FAD_binding_6" amino acids 94 to 184 (91 residues), 35.6 bits, see alignment E=2e-12 PF00175: NAD_binding_1" amino acids 197 to 300 (104 residues), 31.9 bits, see alignment E=3.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1503)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD22 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Shew_1503 oxidoreductase FAD-binding subunit (RefSeq) (Shewanella loihica PV-4)
MTTFYLDGQAFEAKAGESVLDTLIRHGQRVNYSCKKGVCKTCLLQHVDGEMAIGAQRGLT
LGLKQRHYLCSCQCKPTPALRLKSILPQDLFIGAKIQEKQFINEAVVRVRLVLDEPLAHH
PGQYINLRRFDGLTRSYSPTSLPGEPFLELHVRRKYNGQFSDWLYHHAGIGESLLVQGPL
GSRYYRTAYRDAKLIIVAFGSGLGVAHGMLMQALAQGHQGEIFLYVGARDDNDLYLHPKL
LKMMLEHRQFHYQACITGQSESKGRRVIHANPFSEALKCHQFDRQQHLFLCGEPGLVNES
REIAFLNGFPIERIHSLSFEYKDLRKRPRG