Protein Info for Shew_1491 in Shewanella loihica PV-4

Annotation: Ion transport protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details PF00520: Ion_trans" amino acids 26 to 241 (216 residues), 129.6 bits, see alignment E=1.1e-41 PF07885: Ion_trans_2" amino acids 161 to 236 (76 residues), 54.2 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1491)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD10 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Shew_1491 Ion transport protein (RefSeq) (Shewanella loihica PV-4)
MDETPQEARKQKLREIIFGTDTPAGRYFDLSLIVCIVLSVALVFVDTIDSVHNRYGDWIR
IAEWGFTGIFTLEYLLRLYCSAHPVQYARSFYGVVDLLSILPSYLALIFPGANFTLVIRV
LRLFRIFRVLKLLRYLSEGNILLRAMMQSSRKVFLFFFSVSLIVMVLSAIMYVVEGPEHG
FTSMPKSIYWTIVTITTVGYGDITPQTTLGQGIAALTMLIGYSIIAIPTGILTSEISQEM
VRKKDLRRCSNCLKMGHEVSALYCDKCGNELETDL