Protein Info for Shew_1472 in Shewanella loihica PV-4

Annotation: nucleoid-associated protein NdpA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF04245: NA37" amino acids 9 to 332 (324 residues), 356.1 bits, see alignment E=1.1e-110

Best Hits

Swiss-Prot: 90% identical to NDPA_SHEPA: Nucleoid-associated protein Spea_1765 (Spea_1765) from Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

KEGG orthology group: K06899, nucleoid-associated protein (inferred from 100% identity to slo:Shew_1472)

Predicted SEED Role

"Nucleoid-associated protein NdpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCZ1 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Shew_1472 nucleoid-associated protein NdpA (RefSeq) (Shewanella loihica PV-4)
MSINVEQAIIHAISQDGEGQLSCRLRPQPLLNSQAVEAMLEELHQTYTSKSGKGFGHFGT
HGEDGEANPQFKEALSQYLGGELGFVEFSGMAGKLLQEELAKYDFSQGGFLLLACYTYMT
SDYLFVSLLNAKSSMTVLDDMELSQNTHLDLNNVQLAARIDLTEWQADPDSLKYISFVRG
RAGRKVADFFLDFMGCVEGVNTKAQNKSLMNAVEDFVASSELTKDERQQCREKVFEYCTE
RVDSGADIQLKDLADELADAGMDSFYDFAQGGDYELEEEFPGDKPTLRQLKKFSGTGGGV
TISFDGQHLGERVIYDPISDSILIKGVPANLKDQLDRRLKGGQ