Protein Info for Shew_1455 in Shewanella loihica PV-4

Annotation: dual specificity protein phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF22784: PTP-SAK" amino acids 4 to 128 (125 residues), 35.3 bits, see alignment E=2.4e-12 PF22785: Tc-R-P" amino acids 24 to 121 (98 residues), 39 bits, see alignment E=2.1e-13 PF00782: DSPc" amino acids 66 to 135 (70 residues), 42 bits, see alignment E=1.6e-14 PF13350: Y_phosphatase3" amino acids 79 to 120 (42 residues), 30.9 bits, see alignment E=5.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1455)

Predicted SEED Role

"Protein tyrosine phosphatase (EC 3.1.3.48)" (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCX4 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shew_1455 dual specificity protein phosphatase (RefSeq) (Shewanella loihica PV-4)
MQQLFWLVEGELAGRCGPNLVPWDLSELKAQGVGAILSVNGGDLCDPDEMARLALRYACI
PLSGNIPPMEGDEAHCVAQLPKALAFIRQCEADGLPVMIHCRSGKDRTGLLMAYYLMENG
AAPLHAVSQVRAVRDIAFSAEGWDQFVYDVLYALQE