Protein Info for Shew_1454 in Shewanella loihica PV-4

Annotation: DEAD/DEAH box helicase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00270: DEAD" amino acids 48 to 217 (170 residues), 164.5 bits, see alignment E=3.7e-52 PF04851: ResIII" amino acids 49 to 214 (166 residues), 26.9 bits, see alignment E=8.2e-10 PF00271: Helicase_C" amino acids 253 to 361 (109 residues), 103.1 bits, see alignment E=2.1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1454)

Predicted SEED Role

"ATP-dependent RNA helicase VF1437" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCX3 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Shew_1454 DEAD/DEAH box helicase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MTTNALDPSALEPSAPSALSLSTTDFSQLNLVKALQARLHHLGYQQATPIQAKAIPAILA
GRDLLAGAKTGSGKTAAFALPLLQKLVGQRAGGGNHVGALVLVPTRELAQQVADSFISYG
AELAPRAKVIAVFGGVSVNSQMLALRGGADILVATPGRLLDLLGSNAVKLSQLKALVLDE
ADRMLNLGFTEELGEILKQLPDQKQTLLFSATFPEEVLSLTAKLLTDPVEIQMQEAQSAD
IEQRVYTVNRSNKTALLAELIKVRQWRQVLVFASAKRSCDHLAQKLEKRGISAQVFHGDK
AQGARSRVLDGFKNGEITVLIATDIAARGIDIDKLPVVINFELPRSPADYLHRIGRSGRA
GETGEAISLISHDEYHHFKVIEKKNKLRLPREQYPGFEADAEAPLDCPSRQDKPMAKPEG
TGKKKRKKLPKINDAIWKRPS