Protein Info for Shew_1435 in Shewanella loihica PV-4

Name: phhA
Annotation: phenylalanine 4-monooxygenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00351: Biopterin_H" amino acids 22 to 246 (225 residues), 181.8 bits, see alignment E=9.1e-58 TIGR01267: phenylalanine-4-hydroxylase" amino acids 23 to 268 (246 residues), 329.7 bits, see alignment E=4.9e-103

Best Hits

Swiss-Prot: 61% identical to PH4H_PSEAE: Phenylalanine-4-hydroxylase (phhA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00500, phenylalanine-4-hydroxylase [EC: 1.14.16.1] (inferred from 100% identity to slo:Shew_1435)

Predicted SEED Role

"Phenylalanine-4-hydroxylase (EC 1.14.16.1)" in subsystem Aromatic amino acid degradation or Pterin biosynthesis (EC 1.14.16.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.16.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCV4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Shew_1435 phenylalanine 4-monooxygenase (RefSeq) (Shewanella loihica PV-4)
MEAGAVICVVFIMSKQTTYQARLPDSQGVIQYPDNEHEIWQALYDRQKGNLPHYACDAYL
KGLEDLALPADRIPQLGEIDAVLQQATGWKTAAVPALISFEKFFQLLANQEFPVATFIRS
KEEFDYLQEPDIFHEIFGHCPLLTNPSFARFSHEYGKLGLAASKEERVFLARLYWFTVEF
GLIRQTNDELKIYGGGILSSPGETLYAMSDTPVVKPFDLLDILRTPYRIDIMQPIYYAID
SIDYLDEIVKMDIMGAVTKARQLGLHAPMFEPKSKAS