Protein Info for Shew_1432 in Shewanella loihica PV-4

Annotation: ferredoxin-type protein NapF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00402: ferredoxin-type protein NapF" amino acids 16 to 155 (140 residues), 144.1 bits, see alignment E=1.6e-46 PF13237: Fer4_10" amino acids 33 to 79 (47 residues), 26.1 bits, see alignment E=3.2e-09 PF12800: Fer4_4" amino acids 34 to 48 (15 residues), 15 bits, see alignment (E = 1.3e-05) amino acids 66 to 79 (14 residues), 13.9 bits, see alignment (E = 3e-05) amino acids 138 to 152 (15 residues), 13.7 bits, see alignment (E = 3.5e-05) PF12838: Fer4_7" amino acids 36 to 79 (44 residues), 36.5 bits, see alignment E=2.7e-12 amino acids 109 to 152 (44 residues), 28.7 bits, see alignment E=7.4e-10 PF13187: Fer4_9" amino acids 36 to 80 (45 residues), 27.1 bits, see alignment E=1.8e-09 PF00037: Fer4" amino acids 63 to 79 (17 residues), 25.6 bits, see alignment (E = 4e-09) amino acids 133 to 155 (23 residues), 28.3 bits, see alignment 5.8e-10 PF12797: Fer4_2" amino acids 131 to 151 (21 residues), 24.7 bits, see alignment (E = 8e-09)

Best Hits

Swiss-Prot: 44% identical to NAPF_ECOLI: Ferredoxin-type protein NapF (napF) from Escherichia coli (strain K12)

KEGG orthology group: K02572, ferredoxin-type protein NapF (inferred from 100% identity to slo:Shew_1432)

Predicted SEED Role

"Ferredoxin-type protein NapF (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCV1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Shew_1432 ferredoxin-type protein NapF (RefSeq) (Shewanella loihica PV-4)
MSNRINQSRRNLFSRRKSQVIRPPWSSTDVEFTDICTRCDKCIDACETKILSRGDGGFPE
VSFSQDECTFCGACAKVCPEPLFTDTEETPWQIKASIDQSCLANSGIWCQTCKDACDPRA
ISFTASIGQAPKPVIDTEMCNGCGACVAPCPNQSIKLS