Protein Info for Shew_1422 in Shewanella loihica PV-4

Annotation: sulfate adenylyltransferase subunit 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02039: sulfate adenylyltransferase, small subunit
  • amino acids 8 to 301 (294 residues), 532 bits, E=2.5e-164
• PF01507: PAPS_reduct
  • amino acids 28 to 255 (228 residues), 194.6 bits, E=7.1e-62

Best Hits

Swiss-Prot: 100% identical to CYSD_SHELP: Sulfate adenylyltransferase subunit 2 (cysD) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 100% identity to slo:Shew_1422)

MetaCyc: 78% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• assimilatory sulfate reduction II (1/3 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

See A3QCU1 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Shew_1422 sulfate adenylyltransferase subunit 2 (RefSeq) (Shewanella loihica PV-4)
MSTQQTHLKQLEAESIQIMREVAAEFENPVMLYSVGKDSSVLLHLARKAFYPGKIPFPLL
HVDTNWKFKEMIEFRDRMAKQYGFDLIVHKNPRGLEMNISPFTHGSAKHTDIMKTEGLKQ
ALDMHGFDAAFGGARRDEEKSRAKERVYSFRDSKHRWDPKNQRPELWNIYNGKVDKGESI
RVFPLSNWTELDIWQYIYLENIEIPSLYLAEPRPVVKRDGTLIMVDDERMELEPGEAVEQ
KMVRFRTLGCYPLTGAVESQATTLPEIIQEMLLCTTSERQGRVIDNDSAGSMEKKKMEGY
F