Protein Info for Shew_1406 in Shewanella loihica PV-4

Annotation: polysaccharide biosynthesis protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 228 to 241 (14 residues), see Phobius details amino acids 259 to 274 (16 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 461 to 483 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1406)

Predicted SEED Role

"putative flippase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCS7 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Shew_1406 polysaccharide biosynthesis protein (RefSeq) (Shewanella loihica PV-4)
MNKKIIVNTLALYSRQALVVLINLYVVRIVLNELGVSDYGVYNVILGVTAIFSFIPSAMT
VSVQRQFVFSIEKGRESLKRCFSSCLVIYLLMIALSSMLFFTFGSFFVKEYLVIPEQRLS
PALTLFYFSIVIFILSIATSLLTSLVISHENMKVYAILSVIEALLKLMSAFILAYEIEDK
LITYGALVMLSSLIVFMLYNVACIKYYKKYRISIIGFDKQLFVDTVKFSSWTLFGFFTSV
LRTHATTLLINQWFNPVVVAARVISNTISSQLMIFANNLNVSLYPPIVRNYANKDVNGVN
TILIEGSKISFFLVWLLALPMLVETEFFLKVWLVTPPVDSISFTRLALIEALLMSLGLVV
GSAARATGKIKKYELILGAVQILTFVVTVFVLYIGYPAYSVFVIGIVTNLIMLFLRLCIL
QFLMGFSMKAFISKVLPTVSFMVITSSVFSVFLRQEFQNGWARVVVTLFIGTFFSFLVMY
KYGLSAELKIKLKSKLIDWIRR