Protein Info for Shew_1380 in Shewanella loihica PV-4

Name: flhA
Annotation: flagellar biosynthesis protein FlhA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 240 to 267 (28 residues), see Phobius details amino acids 288 to 304 (17 residues), see Phobius details amino acids 310 to 326 (17 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 22 to 697 (676 residues), 866.6 bits, see alignment E=6.1e-265 PF00771: FHIPEP" amino acids 31 to 689 (659 residues), 890.9 bits, see alignment E=3e-272

Best Hits

Swiss-Prot: 43% identical to FLHA_CAUVC: Flagellar biosynthesis protein FlhA (flhA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 100% identity to slo:Shew_1380)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCQ1 at UniProt or InterPro

Protein Sequence (699 amino acids)

>Shew_1380 flagellar biosynthesis protein FlhA (RefSeq) (Shewanella loihica PV-4)
MDLKATLGQIKQVKPANFKGIGTPILVLAALAMIVLPMPAFLLDILFSFNIALALVVLLV
AIYTDRPLDFAAFPTVLLVATLLRLALNVASTRIVLLEGHNGGDAAGKVIEAFGSVVIGG
NYAVGLVVFLILIIINFAVVTKGAGRISEVSARFTLDAMPGKQMAIDADLNAGILNQDQA
RIRRAEVTKEADFYGAMDGASKFVKGDAIAGIMILVINILGGFVIGMAQHGLDFSSAVEI
YTLLTIGDGLVAQIPGLLLSIAAALMVTRQNESGDMGQMVMSQMFDNPKSLAIAAGVLLT
MGIVPGMPHFAFLSFGLITAGGAYFLHRKKDLDRQRALEIAKSSPATPGDAKPKELSWDD
VQQVDTIGLEVGYRLIPLVDKGQGGELLGRIKGVRKKLSQELGFLVPAVHIRDNLDLAPN
TYRISLMGVASGEADIRHDCELAINPGQVYGKLDGVETTDPAFGLEAVWIAPELREHAQT
LGYTVVDAATVVATHLSQLLTNNASKLLGYEEVQQLMDMLAKHSPKLVSGFIPDVLPLGT
VVKVMQNLLNEGVSIRDLKTIVQTLLEYGPKSNDTEVLTAAVRIALKRMIVQEISGPEPE
IPVITLAPELEQMLHQSMQATGGEGPNIEPSLAERMQKSLLDASQRQEMVGQPAILLTSG
MLRSTLSRFVKHTIPNLRVISYQEVPDEKQIRIVSAVGQ