Protein Info for Shew_1376 in Shewanella loihica PV-4

Name: fliP
Annotation: flagellar biosynthesis protein FliP (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 83 (32 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 57 to 253 (197 residues), 286 bits, see alignment E=7.7e-90 PF00813: FliP" amino acids 57 to 249 (193 residues), 275.7 bits, see alignment E=1.2e-86

Best Hits

Swiss-Prot: 65% identical to FLIP_PSEAE: Flagellar biosynthetic protein FliP (fliP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to slo:Shew_1376)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCP7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Shew_1376 flagellar biosynthesis protein FliP (RefSeq) (Shewanella loihica PV-4)
MNPIKIMKRILTPLLLLLAVMAPQLALAQDGILPAVTVTTGADGSTQYSVTMQILLLMTA
LSFLPAMVIMLTSFTRIIVVLSILRQAIGLQQTPSNQVLIGMSLFMTFFIMAPVFDKIYD
QAVKPYIDETMTIEQAYDKGKEPLRAFMLAQTRLTDLETFVQISGYQNIQSPEDAPMSVL
IPAFITSELKTAFQIGFMLFVPFLVLDLVVASILMAMGMMMLSPMIVSLPFKIMLFVLVD
GWSLVMGTLANSFGI