Protein Info for Shew_1375 in Shewanella loihica PV-4

Annotation: flagellar biosynthesis protein, FliO (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 36 to 102 (67 residues), 71.3 bits, see alignment E=2.7e-24 PF04347: FliO" amino acids 48 to 120 (73 residues), 63 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 36% identical to FLIO_PSEAE: Flagellar protein FliO (fliO) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 100% identity to slo:Shew_1375)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCP6 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Shew_1375 flagellar biosynthesis protein, FliO (RefSeq) (Shewanella loihica PV-4)
MGISSLMAVAAAATTTQVTGERESALATMTNMLGGLLVVIALIFLLAYLVKRLKLVPSSH
GVLKTLAVTPLGQREKMVLVEVDGQQYLLGVTPQQVSLIDKLDTPITIEQDSFASRLRQA
KSSQS