Protein Info for Shew_1364 in Shewanella loihica PV-4

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 90 bits, see alignment E=4.2e-29 PF00158: Sigma54_activat" amino acids 134 to 294 (161 residues), 229.4 bits, see alignment E=7.2e-72 PF14532: Sigma54_activ_2" amino acids 143 to 299 (157 residues), 71.3 bits, see alignment E=3.4e-23 PF07724: AAA_2" amino acids 150 to 277 (128 residues), 28.9 bits, see alignment E=3.8e-10 PF07728: AAA_5" amino acids 152 to 270 (119 residues), 31.8 bits, see alignment E=4.8e-11 PF02954: HTH_8" amino acids 400 to 437 (38 residues), 45 bits, see alignment 2.6e-15

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 100% identity to slo:Shew_1364)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCN5 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Shew_1364 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MAEAKILLVEDDAALREALVDTLLLAQYECVDVESAEAAIVALKGQEFDMVISDVQMEGI
GGLGLVNYLQQHNAQVPILLMTAFATIDSAVSAIKLGAVDYLAKPFAPEVLLNQVSRYLK
PKLIEDQPVVADERSLALLALAQKVAQSDASVMIMGPSGSGKEVLARYIHQHSQRANEPF
VAINCAAIPENMLEATLFGYEKGAFTGAYQACPGKFEQAQGGTLLLDEISEMDLGLQAKL
LRVLQEREVERLGGRKTIKLDVRVLATSNRDLKAMATKGDFREDLYYRINVFPLTWPALH
QRPADILPLARHLVLRHAKAAGLAVAPSLDDQASRRLLGHRWPGNVRELDNVVQRALILQ
TGDTICAKDIVIDTQDVMLEPAFDSEKTVEPEGLGDELKAQEHVIILETLNQCNGSRKQV
AEKLGISARTLRYKMARMRDMGIQIPA