Protein Info for Shew_1354 in Shewanella loihica PV-4

Annotation: flagellar hook-associated protein FlgK (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 TIGR02492: flagellar hook-associated protein FlgK" amino acids 5 to 338 (334 residues), 204.7 bits, see alignment E=1.7e-64 PF00460: Flg_bb_rod" amino acids 6 to 35 (30 residues), 24.6 bits, see alignment (E = 4.1e-09) PF22638: FlgK_D1" amino acids 93 to 322 (230 residues), 210.5 bits, see alignment E=5.6e-66 PF06429: Flg_bbr_C" amino acids 596 to 633 (38 residues), 39.5 bits, see alignment 6.4e-14

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 100% identity to slo:Shew_1354)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCM5 at UniProt or InterPro

Protein Sequence (638 amino acids)

>Shew_1354 flagellar hook-associated protein FlgK (RefSeq) (Shewanella loihica PV-4)
MSMDLLNIARTGVLASQSQLAVTSNNITNANTQGYHRQVAEQSSLESQRLGNSFYGAGTY
ITDVKRIYNEYAARELRIGQTALSQAQTTQTKMSELDQLFSQIGKAVPQSLNDLFAGLNS
LADLPDDMGIRGSLLGNADQIAKALNQMQSQLDGQMKQTNDQISAMTDRINEISTELGHI
NQELMKSQGADMQLLDKQDALIQELSEYAQVNVIPLESGAKSIMLGGAVMLVSGEVSMQM
GATTGDPYPGELRITTTAGNQTLVVDPSKMGGSLGALFQFRDETLIPAQLEMGQLALGIA
DSFNQAQSQGFDLNGEVGSDLFLDINDPAMSVGRAGAYGNNTGNAALRVNIDDVNALSGG
SYELTFTAPATYELRDQETGTVTPLTLNGSQLTGGDGFSINIDSGAMASGDRFEIRPTSG
AAAGIKVVMTDPKGIAAAAPKITQDAANSGNTQVKLVSIDNRSVANFPLTGSELTFEIDT
TANTFEVFDAAGNSLGAPTAFTPPSISAYGFTFEVDASAPATDRFTFDLSFAEGDNTNAV
AMAKLAETKLMNNGGSTLADVYEGTKLQVGGKAKAAEVAFGSAEAVYSQAYTRVQSESGV
NLDEEAANLMRFQQSYQASARIMTTATEIFDTLFSSVR