Protein Info for Shew_1334 in Shewanella loihica PV-4

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00195: Chal_sti_synt_N" amino acids 50 to 172 (123 residues), 29.1 bits, see alignment E=1e-10 PF08545: ACP_syn_III" amino acids 114 to 191 (78 residues), 47.3 bits, see alignment E=2.4e-16 PF08541: ACP_syn_III_C" amino acids 236 to 324 (89 residues), 86.2 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to slo:Shew_1334)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCK5 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Shew_1334 3-oxoacyl-(acyl-carrier-protein) synthase (RefSeq) (Shewanella loihica PV-4)
MTITSVNKVSITGIVSVLPEISCENIDESSSSAREEMARIVASTGIRARRVASADQTALS
LGKVACESLIDAMDWKPEEISLVVFVTQTPDYPLPGNAVQLQHQLGLSKDTIAYDVNLGC
SGFVYGLWQVAQLVAGLSKGKALLVVGDTTTHQYRQDNRAVSSLFGDAVSAIAIEKCMES
DEMVFSLGTDGAGAPYLIQPKGGALCPGESPELFMDGMQVFVFTLREVPSSITACLAAKG
WQNADVDYCVMHQANEMMLKRLGDKLGLTHEQLVISMGEVGNTSSASIPLALGLSLSEPL
LKGSVNLVLSGFGVGWSWGTVALTLTKLKVCQVIDLSLAQ