Protein Info for Shew_1329 in Shewanella loihica PV-4

Annotation: N-acylneuraminate-9-phosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR03586: pseudaminic acid synthase" amino acids 18 to 344 (327 residues), 506.8 bits, see alignment E=1.3e-156 PF03102: NeuB" amino acids 39 to 277 (239 residues), 291 bits, see alignment E=6.8e-91 PF08666: SAF" amino acids 292 to 349 (58 residues), 39.5 bits, see alignment E=6.8e-14

Best Hits

Swiss-Prot: 47% identical to PSEI_CAMJJ: Pseudaminic acid synthase (pseI) from Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 100% identity to slo:Shew_1329)

MetaCyc: 46% identical to pseudaminic acid synthase (Campylobacter jejuni)
RXN-10002 [EC: 2.5.1.97]

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.56 or 2.5.1.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCK0 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Shew_1329 N-acylneuraminate-9-phosphate synthase (RefSeq) (Shewanella loihica PV-4)
MFTPNISINGRQIGPQHKPYVIAELSGNHKGSLSKALSMIDAAAATGVDAIKIQTYSADT
ITLDHDSPEFLLQGGLWAGRTLYDLYQEAHTPWEWHEALFERAKQNNIALFSSPFDLSAI
ELLESLNCPAYKIASFEINDIGLITAAAKTGKPLIISTGLATLAEIEEAVEAVADAGGNQ
LALLHCISGYPTPIEDCNLRTLTDLCQRFDFPIGLSDHTLETTAAITAIALGASIIEKHF
TLDRNDGSVDAAFSLEPDAFATLKQEVDKAHLALGHAGYEIKPSEAGGRDFRRSLYVSQA
IKKGESFTRDNVRSVRPAHGLHTRYLPQILGQKASQDIAFGEPMRESYLSKPLVKRED