Protein Info for Shew_1310 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 34 to 36 (3 residues), see Phobius details transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 38 to 311 (274 residues), 207.4 bits, see alignment E=6.7e-65 PF17203: sCache_3_2" amino acids 100 to 215 (116 residues), 38.9 bits, see alignment E=1.8e-13 PF17202: sCache_3_3" amino acids 107 to 214 (108 residues), 102.1 bits, see alignment E=4.2e-33 PF00015: MCPsignal" amino acids 457 to 633 (177 residues), 135.5 bits, see alignment E=3.6e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1310)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCI1 at UniProt or InterPro

Protein Sequence (667 amino acids)

>Shew_1310 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella loihica PV-4)
MNYKNWPIAKQIGALALILTVVVFAILSSVSYITAANVLEDKGKTAVKAQMHSTADLIEL
EYNSLLSLARRNADVLRAMYPGQFFKPDKTVLVMGKPTPALVHEREQINASKSKVDRYSN
LTGGNATVFVRDGDDFIRISTSLKKADGKRALGTYLGKKHPGYGALMAGKEYEGYARLFG
KDYMTVYRPITGPQGDIIGILYIGFDISEALTELQRSMNQLKLEESGYFTLIRNVDNAII
AQPNQESGTILTEAILDGLSLDAAKRGGQESEYLNSNKEPMYAYAVTIPGWQWTLLGQAK
KRELNEESLKLLSINAGVAAVGVLLITLLLSMVLIKTLRPLRHLQHQLTELGKGDLTQEF
DQVSPDTDNEVDRITHAARQMALSLRELVGALRASVNTLEEQASSAQEVARLNGEEAQQL
MAQTDQIATAIEEMSTSVRDVANHASEGASQSQQVDNASRDGHQQLDQLVQGLGKLSEQL
DASHMSVENVSKESEAISQVTEVINSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVR
TLAQRTQTSISEISQTITQLQQQIKLTAEQMGQSHQLGTASAAQGQEAATNLNQITISIG
ELAIASSSIASATEQQSAVADEITRNLHEITELARDGEQRAGDTVDAAQNLSHIAAEIKQ
KISVFKS