Protein Info for Shew_1299 in Shewanella loihica PV-4

Annotation: CMP/dCMP deaminase, zinc-binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 17 to 115 (99 residues), 98.8 bits, E=1.6e-32
• PF14437: MafB19-deam
  • amino acids 18 to 163 (146 residues), 131 bits, E=3e-42

Best Hits

Swiss-Prot: 58% identical to TADA_SALTY: tRNA-specific adenosine deaminase (tadA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11991, tRNA-specific adenosine deaminase [EC: 3.5.4.-] (inferred from 100% identity to slo:Shew_1299)

MetaCyc: 56% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

See A3QCH1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Shew_1299 CMP/dCMP deaminase, zinc-binding (RefSeq) (Shewanella loihica PV-4)
MSNPIEKQTSLDEQAVKDEAYMRQAMALAAQAELRGEVPVGALLVKDDSVIATGYNLSIC
RHDASAHAEMECIRAAGQVMENYRLLDTTLYVTLEPCAMCAGAMVHARIGRLVFGAADLK
TGAAGSVVDLVRSSAFNHQLEVTAGVLAEDCGEQLSAFFRRRRQEKKALKMAEKKQGQ