Protein Info for Shew_1298 in Shewanella loihica PV-4

Name: guaA
Annotation: bifunctional GMP synthase/glutamine amidotransferase protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 9 to 205 (197 residues), 268.9 bits, E=1.7e-84
• PF00117: GATase
  • amino acids 10 to 200 (191 residues), 156.1 bits, E=2.7e-49
• PF07722: Peptidase_C26
  • amino acids 74 to 183 (110 residues), 39.3 bits, E=1.9e-13
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 525 (313 residues), 510.7 bits, E=1.5e-157
• PF02540: NAD_synthase
  • amino acids 221 to 255 (35 residues), 28.2 bits, 3.2e-10
• PF00958: GMP_synt_C
  • amino acids 433 to 524 (92 residues), 145.3 bits, E=1.4e-46

Best Hits

Swiss-Prot: 100% identical to GUAA_SHELP: GMP synthase [glutamine-hydrolyzing] (guaA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to slo:Shew_1298)

MetaCyc: 83% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (45/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (25/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A3QCH0 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Shew_1298 bifunctional GMP synthase/glutamine amidotransferase protein (RefSeq) (Shewanella loihica PV-4)
MSNIHDHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKAFAPNGIILAGGPE
SVTADNSPRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVEVQAASE
LFKSIEDAVSDSGKALLDVWMSHGDKVSEIPEGFVTVAKTDTCPYAAMANEEKRFYGVQF
HPEVTHTRQGKRMLEHFALDICQCEANWKPSSIIEDAVARIKEQVGDDEVILGLSGGVDS
SVVAMLLHRAIGSKLTCVFVDNGLLRLNEADQVLEMFGDHFGLNIVHVDAESRFLDALAG
EAEPEAKRKIIGKVFVDIFDEESRKCVNAKWLAQGTIYPDVIESAGSATGKAHVIKSHHN
VGGLPDDMELGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF
MTAHWAHLPYDFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE