Protein Info for Shew_1296 in Shewanella loihica PV-4

Name: xseA
Annotation: exodeoxyribonuclease VII large subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF13742: tRNA_anti_2" amino acids 9 to 101 (93 residues), 109.9 bits, see alignment E=8.9e-36 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 10 to 356 (347 residues), 435.5 bits, see alignment E=1e-134 PF01336: tRNA_anti-codon" amino acids 29 to 101 (73 residues), 41.1 bits, see alignment E=2.1e-14 PF02601: Exonuc_VII_L" amino acids 125 to 439 (315 residues), 359.9 bits, see alignment E=2.3e-111

Best Hits

Swiss-Prot: 100% identical to EX7L_SHELP: Exodeoxyribonuclease 7 large subunit (xseA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to slo:Shew_1296)

MetaCyc: 52% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCG8 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Shew_1296 exodeoxyribonuclease VII large subunit (RefSeq) (Shewanella loihica PV-4)
MKMPKNNVYTVSRLNGEVRQLLEGELGKVWLEAEISNFSAPSSGHWYLTLKDNYAQIRAA
MFKGRNRAVTFRPANGQQVLVKGAISVYEPRGDYQLIIDSMLPAGDGLLAQQYEALKMKL
AAEGLFAADTKRPLPSNIQRIGVVTSATGAAIRDVLHVLKRRDPSIEVIIYPSQVQGEHA
DKSLCHAIMQANDRMEVDVLLLTRGGGSLEDLWCFNSEALAHTIYNSALPVVSAVGHEVD
TTISDYVADLRAPTPSAAAELLSQDALSKADKLRMTMTRLKQGWQHYGLKQAQRFSQLHH
RLERQDPKRRLQQYEQRFDELQLRLGAALTGKLHQMERRQQSLHARLNQVSPSHQLALAA
SRLTHQNQRLHSAMQARLNSAEKSLQYAAHQLETVSPLATLSRGYSITLDTEGKVLHSAQ
DVRTGARLTTKLVDGEVQSTVI