Protein Info for Shew_1293 in Shewanella loihica PV-4

Annotation: outer membrane protein assembly complex subunit YfgL (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 7 to 392 (386 residues), 430.9 bits, see alignment E=1.7e-133 PF13360: PQQ_2" amino acids 47 to 101 (55 residues), 23.3 bits, see alignment 6.9e-09 amino acids 111 to 321 (211 residues), 187.2 bits, see alignment E=5.8e-59 PF01011: PQQ" amino acids 122 to 157 (36 residues), 23.2 bits, see alignment 6.3e-09 PF13570: PQQ_3" amino acids 141 to 180 (40 residues), 20.4 bits, see alignment 8.5e-08

Best Hits

Swiss-Prot: 76% identical to BAMB_SHEON: Outer membrane protein assembly factor BamB (bamB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1293)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCG5 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Shew_1293 outer membrane protein assembly complex subunit YfgL (RefSeq) (Shewanella loihica PV-4)
MKSWCKTLLACSLSLGLLSACSSNDVEEEPVSPLPQIEASVFPEVSWSASVGSGVGDYYS
KIRPAVRYGKLFVMDRYGEVAAYDEATGEQVWSLEISSWFKEGALSKNKGARLSSGITAA
RNKVFFGGESGLLGAVDAETGEMVWHVTAGGELLSAPTVGEDVVVVHTSTGALEAYNVDD
GKQLWVYESKLPTLTLRGTGSAAYEAGGFFVGTADGKVAVVVKSNGQAAWEQPIYTPKGG
NEFTRMADVDMKPLIVGENIYAVSYNGNLVSMELRTGRVVWSRKYSSFNELASAGLNLYL
VDDHGRVYAVDKRNGLESWSNSELTNRELTSPVVFKDYLVVGDFEGYLHFIDRASGKLVG
RVEVDSSGLFSQPLVIDDKIYVQSRGGKVARITLP