Protein Info for Shew_1276 in Shewanella loihica PV-4

Updated annotation (from data): Isocitrate lyase (EC 4.1.3.1)
Rationale: Specifically important for utilizing Potassium acetate. Automated validation from mutant phenotype: the predicted function (4.1.3.1) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: isocitrate lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 24 to 271 (248 residues), 383.2 bits, E=8.6e-119
  • amino acids 272 to 450 (179 residues), 300.6 bits, E=9.4e-94
• PF00463: ICL
  • amino acids 25 to 271 (247 residues), 199.4 bits, E=9.8e-63
  • amino acids 273 to 450 (178 residues), 171.1 bits, E=3.7e-54
• PF13714: PEP_mutase
  • amino acids 97 to 321 (225 residues), 60.5 bits, E=2e-20

Best Hits

Swiss-Prot: 82% identical to ACEA_SALTY: Isocitrate lyase (aceA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 100% identity to slo:Shew_1276)

MetaCyc: 81% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

See A3QCE8 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Shew_1276 Isocitrate lyase (EC 4.1.3.1) (Shewanella loihica PV-4)
MLTPEMEKIMTKATTQISRQQQIDAIKQDWAENPRWAGVRRPYSAEDVVALRGSIVPENT
LATRGAEKLWQLVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGT
MYPDQSLYPANSVPAVVQRINNSFRRADQIQWSNEIDPQDERYTDYFLPIVADAEAGFGG
VLNAYELMKNMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVSARLAADVSG
VPTLVIARTDANAADLLTSDCDPYDRDFITGERTSEGFYRVNAGIDQAISRGLAYAPYAD
LIWCETAKPDLEEARRFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQELSDMG
YKYQFITLAGIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVG
TGYFDKVTNVIQGGESSVTALTGSTEEEQF