Protein Info for Shew_1267 in Shewanella loihica PV-4

Annotation: phage integrase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF13356: Arm-DNA-bind_3" amino acids 8 to 94 (87 residues), 80.7 bits, see alignment E=1.4e-26 PF14659: Phage_int_SAM_3" amino acids 106 to 156 (51 residues), 25 bits, see alignment 3.6e-09 PF22022: Phage_int_M" amino acids 108 to 201 (94 residues), 86 bits, see alignment E=3.4e-28 PF00589: Phage_integrase" amino acids 213 to 378 (166 residues), 90.7 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1267)

Predicted SEED Role

"Phage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCD9 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Shew_1267 phage integrase family protein (RefSeq) (Shewanella loihica PV-4)
MAVITTPLTNTQIKNQKPGPKDIVLSDGGGLQLRVRTNGSKLWNYNYYHPVTKKRVNIGI
GPYPDIPLAKAREIALEYRQLVACGVDPKSKREQESLKLKQEVLYTLKNVAAEWLEIKKS
EVTKSHAAKTWSSLESHVFPELGDTPLNKITAPLVIKVFRPIEAKGSLETIKRLSQRLNE
IMNFGVNCGYIDSNPLVGIRAAFKKPKKESMATLTPSELPLLMRHLSQASIKRVTRCLIE
WQLHTMTRPSEAATARWDELDLDNLTWTIPAEKMKRRREHVIPLTQQMLGILDAIKPISG
HRDYIFPADRDPKSHCNTQTANVALKRMGLKGKLVSHGMRALASTTLNEQGFESDLIEAA
LSHVDANQVRAAYNRSDFLERRRPMMSWWSKHIEEASQGNLSVSCRRVS