Protein Info for Shew_1236 in Shewanella loihica PV-4

Annotation: OsmC family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 77 to 94 (18 residues), see Phobius details PF02566: OsmC" amino acids 66 to 166 (101 residues), 72.4 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1236)

Predicted SEED Role

"Predicted redox protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCA8 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Shew_1236 OsmC family protein (RefSeq) (Shewanella loihica PV-4)
MSFSVTVSWPPATHGSHHTAQNSGPLQREPLAKDSGTGDEKISRDHQLSFASGQVVAGSA
APEYQGSQEKVNPEESLLSALAACHMLSFLTIVAKKRLTLLSYRDEARAELGRNEKGQMA
ITHIALTPEVEMAQPLSEEQLAKLHALAHKHCFIANSLAKEIAIEIAPRQKR