Protein Info for Shew_1216 in Shewanella loihica PV-4

Annotation: regulatory protein RecX (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02631: RecX" amino acids 27 to 144 (118 residues), 102.8 bits, see alignment E=8.6e-34

Best Hits

Swiss-Prot: 42% identical to RECX_VIBCB: Regulatory protein RecX (recX) from Vibrio campbellii (strain ATCC BAA-1116 / BB120)

KEGG orthology group: K03565, regulatory protein (inferred from 100% identity to slo:Shew_1216)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC88 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Shew_1216 regulatory protein RecX (RefSeq) (Shewanella loihica PV-4)
MTMSAMQVAVGLLARRDYSRYQIKSKLSQKGFLDGEIEAVLGQCESQGYLDDARFAGLLL
RSHIAKGHGQNKIRQSMSQKGLTKEIIESSLNQSDCDWFELARQKAAKKYATSGPIQDQK
ERAKRVRYLLSQGFGFDQVAYALEVDPDFD