Protein Info for Shew_1212 in Shewanella loihica PV-4

Annotation: peptidase M23B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01476: LysM" amino acids 61 to 103 (43 residues), 49.9 bits, see alignment 2.5e-17 PF01551: Peptidase_M23" amino acids 209 to 303 (95 residues), 107.1 bits, see alignment E=4.2e-35

Best Hits

KEGG orthology group: K06194, lipoprotein NlpD (inferred from 100% identity to slo:Shew_1212)

Predicted SEED Role

"Lipoprotein NlpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC84 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Shew_1212 peptidase M23B (RefSeq) (Shewanella loihica PV-4)
MLSAPSRLRFCQKPIGILCALLLSCLLSACSFQAHSPAPVVNVNSPVKKAYKKGGLTSDH
YKVKRGDTLYSIAWAANKDFAEIARYNGLRKPYTIYPGQVLKLKSTNAVTNSKTQRSTQV
SSKKTQQNTAKNQPKQTVNSSQQAAASKTALAKKSLDRGDKSAYAVTTGQQNVNGVIHKP
SSTLPKKVQRWHWPVKGKLIGTFSTKEQGNKGIKIAGSRGDRIQAAADGRVVYAGNALRG
YGNLVIIKHSDDYLSAYAHADKILVKEKQFVTAGQTVAKMGQTGTNRVMLHFEIRYHGKS
VDPLKFLPKS