Protein Info for Shew_1201 in Shewanella loihica PV-4

Name: rumA
Annotation: 23S rRNA 5-methyluridine methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 23 to 69 (47 residues), 28.9 bits, 2.4e-10
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 26 to 435 (410 residues), 388.3 bits, E=2.2e-120
• PF05958: tRNA_U5-meth_tr
  • amino acids 101 to 346 (246 residues), 51.5 bits, E=2.5e-17
  • amino acids 369 to 439 (71 residues), 38.8 bits, E=1.8e-13
• PF01135: PCMT
  • amino acids 284 to 354 (71 residues), 25.7 bits, E=2.7e-09
• PF13847: Methyltransf_31
  • amino acids 297 to 379 (83 residues), 36.7 bits, E=9.7e-13
• PF13649: Methyltransf_25
  • amino acids 302 to 357 (56 residues), 33.4 bits, 1.8e-11
• PF08241: Methyltransf_11
  • amino acids 303 to 356 (54 residues), 23.8 bits, 1.7e-08

Best Hits

Swiss-Prot: 63% identical to RLMD_SHESA: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_1201)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A3QC73 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Shew_1201 23S rRNA 5-methyluridine methyltransferase (RefSeq) (Shewanella loihica PV-4)
MAQFYKAKPRKTQQTQAKQSFHVSQLDHLGAGIAEHQGKIVFIPGALPDETVTAQIVEQK
KRHAKAKLIKVESASAARIEASCPYYGRCGGCDLQHLELSAQRDAKQTALENLINKMGRT
QPQTMSEPLSGEGWHYRRRARLATQYLRDTKQLNLGFRALASSEVVNIDACPVLAKSLSE
LIAPLNQCLNRLSAKRSLGHVELLSVDSGPCVVLRITSPLNDKDKALLATFGEQHKVRLV
LLDDDSKLETLWGDEGLPYYTLEDGSSLGFSPGNFIQVNGEINQQMVTQAIDWLQIQPGE
RVLDLFCGVGNFTLPLAKAGAQVVGVEGVDAMVAQARVNATMSGVEGAEFYHGDLSADLS
AAPWLGRIDKLLLDPARAGAYESLQWLKKMKPKAIVYISCNPVSLARDCEPLLAQGYQLS
RLGLIDMFPQTHHIEAMALFELEK