Protein Info for Shew_1197 in Shewanella loihica PV-4

Annotation: auxin efflux carrier (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF03547: Mem_trans" amino acids 6 to 309 (304 residues), 85.8 bits, see alignment E=1.2e-28

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to slo:Shew_1197)

Predicted SEED Role

"TRANSPORTER"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC69 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shew_1197 auxin efflux carrier (RefSeq) (Shewanella loihica PV-4)
MLTTLSPLFVVFGIMVTGFVVQKARLLPEGSDNVLNQYVYYIAFPAIMMIVLAETPIEEI
ANWGFIGGYSLAMTLIYLLTGLLSLWLQPKDKPLAAIRALNTTFGNTSFIGIPLMMMLFP
GDQLALAAAALASLLSVTVFAIVLAQMALFQGQTDSALKTVFFALIQNPIILGSLAGVAI
SAAHIELYRPIAEIIRQFGMTSSPCALFAIGMVLCKANQGGRNAAGIQSRLAELAMLNLS
KLLLQPLLAYLLLGALGVSGQLLQMGVILAALPTAASVYLLAHRFNVGATSSAQTISLGI
VISFATIPLLHHWLDSGTASFL