Protein Info for Shew_1193 in Shewanella loihica PV-4

Annotation: phosphatidylglycerophosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 21 to 49 (29 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details PF04608: PgpA" amino acids 22 to 159 (138 residues), 143.5 bits, see alignment E=2.2e-46

Best Hits

Swiss-Prot: 52% identical to PGPA_ECOLI: Phosphatidylglycerophosphatase A (pgpA) from Escherichia coli (strain K12)

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to slo:Shew_1193)

MetaCyc: 52% identical to phosphatidylglycerophosphatase A (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC65 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Shew_1193 phosphatidylglycerophosphatase (RefSeq) (Shewanella loihica PV-4)
MQLWSTDPVLKKLSLANPVHFLALGFGAGLAAKAPGTFGTLAAIPLYLLMAGLPLGWYLG
LTLLSVLAGFYICDKASKDMGVHDHGAIVWDEVAGLLITLIAAPAGWLWVAVGFGLFRFF
DILKPWPIKVLDAKVHGGIGIMIDDVLAGVFAFLCLQGIVYLVG