Protein Info for Shew_1188 in Shewanella loihica PV-4

Annotation: riboflavin synthase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 197 (197 residues), 207 bits, E=8.7e-66
• PF00677: Lum_binding
  • amino acids 3 to 87 (85 residues), 71.8 bits, E=2e-24
  • amino acids 100 to 184 (85 residues), 87.9 bits, E=1.9e-29

Best Hits

Swiss-Prot: 57% identical to RISA_PHOPO: Riboflavin synthase (ribE) from Photobacterium phosphoreum

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 100% identity to slo:Shew_1188)

MetaCyc: 41% identical to riboflavin synthase monomer (Bacillus subtilis)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.9

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

See A3QC60 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Shew_1188 riboflavin synthase subunit alpha (RefSeq) (Shewanella loihica PV-4)
MFTGIIEAVGSLRKIERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVEQMADGYV
ADISAETVALTGFAHYQVGQKVNLEKAVTPTTRLGGHMVSGHVDGVASVDDRQYRGKAIE
FWLTPPKGLARYIAHKGSITIDGVSLTVNEVDGERFRLTIVPHTASETTLIDLKAGDRVN
IEVDLIARHLERLLSFQAAEENPAKGSEVTMDLLARSGFLR