Protein Info for Shew_1171 in Shewanella loihica PV-4

Annotation: glucose-1-phosphate adenylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 19 to 391 (373 residues), 496.4 bits, see alignment E=2.5e-153 PF00483: NTP_transferase" amino acids 20 to 285 (266 residues), 204.4 bits, see alignment E=2.2e-64 PF24894: Hexapep_GlmU" amino acids 308 to 412 (105 residues), 144.3 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 90% identical to GLGC_SHESA: Glucose-1-phosphate adenylyltransferase (glgC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to slo:Shew_1171)

MetaCyc: 55% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC43 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Shew_1171 glucose-1-phosphate adenylyltransferase (RefSeq) (Shewanella loihica PV-4)
MPNMNPSPRYISNLTRETYALILAGGRGSRLHELTDWRAKPSLYFGGKFRIIDFPLSNCI
NSGIRRIGVVTQYKSHSLIRHVMRGWGHFKKELGESVEILPASQRYSESWYKGTADAVFQ
NIDIIRHELPKYVMILSGDHVYRMDYAGLLAAHAESGADMTVSCLEVPVAEAAGAFGVVE
VDERNKILGFEEKPELPKHLPENPEMCLASMGNYVFNTEFLFEQLKKDAMNENSDRDFGK
DIIPSIIEGHEVYAHPFRSGFTDEEAYWRDVGTLDSFWQANMELLSPTPALNLYDAKWPI
WTFQEQLPPAKFVFDDDERRGMAVDSIVSGGCIISGSTVRRSVLFNEVQVCSYSTVENAV
VLPDVVVLRHCQIKNAILDRGCIIPEGTVIGHDHDHDRARGFRVSEGGITLVTRDMLGLP
VGYE