Protein Info for Shew_1154 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 9 to 82 (74 residues), 83.6 bits, see alignment E=3.6e-28 amino acids 95 to 168 (74 residues), 83 bits, see alignment E=5.5e-28

Best Hits

Swiss-Prot: 47% identical to Y1240_HAEIN: UPF0126 membrane protein HI_1240 (HI_1240) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1154)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QC26 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Shew_1154 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MQEAEFITLLWLIGILAEAMTGALCAGRKQMDLFGVVIIGCATAIGGGTLRDILLGNYPL
IWVENIHYLLAIAFASLLTVIISPVMRYLSKLFLAIDALGLAVFSIVGAQKTLLLGFSPT
LAIVMGVVTGVFGGVIRDILCNQVPLIFKKELYALVSLTTASLYMLLRSFEVTEWINLAI
SLSVGFSFRMLAIRYHWGMPKFDYQHGDHGNQDSQAH