Protein Info for Shew_1123 in Shewanella loihica PV-4

Annotation: A/G-specific adenine glycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR01084: A/G-specific adenine glycosylase" amino acids 21 to 291 (271 residues), 401.3 bits, see alignment E=1.3e-124 PF00730: HhH-GPD" amino acids 51 to 184 (134 residues), 88 bits, see alignment E=7.9e-29 PF00633: HHH" amino acids 116 to 143 (28 residues), 28.5 bits, see alignment (E = 1.5e-10) PF14815: NUDIX_4" amino acids 250 to 359 (110 residues), 86.3 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 59% identical to MUTY_HAEIN: Adenine DNA glycosylase (mutY) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to slo:Shew_1123)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBZ6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Shew_1123 A/G-specific adenine glycosylase (RefSeq) (Shewanella loihica PV-4)
MPFWLRKTLPLYRLSAMKTEQFHQRIVTWYDKHGRKHLPWQQDKTPYKVWVSEIMLQQTQ
VATVIPYFEAFMARFPTILDLANADQDEVLHHWTGLGYYARARNLHKSAQLIASDYDGVF
PTQFEQVLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGKREVEQQL
WQLTNSLTPKTGVTQYNQAMMDIGASICTRSKPRCELCPVAIDCKAQLMGRQTEFPGKKP
KKTIPEKLGYMLVIKDDDRVLMSKRPPAGIWGGLWCFPQFDSQEALEEFAKTNGLTLISE
EPIDSFRHTFSHFHLDISAFVAHQTTSAHEIMEESGSLWYNIAKPPKVGLAAATERILAS
LGSVSNKE