Protein Info for Shew_1107 in Shewanella loihica PV-4

Annotation: methylation site containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details PF07963: N_methyl" amino acids 3 to 27 (25 residues), 37.2 bits, see alignment 1.5e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 37.5 bits, see alignment 6.5e-14 PF16732: ComP_DUS" amino acids 28 to 115 (88 residues), 76.5 bits, see alignment E=2.5e-25

Best Hits

KEGG orthology group: K02655, type IV pilus assembly protein PilE (inferred from 100% identity to slo:Shew_1107)

Predicted SEED Role

"Type IV pilus biogenesis protein PilE" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBY0 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Shew_1107 methylation site containing protein (RefSeq) (Shewanella loihica PV-4)
MQKLKGFTLIEVMITVAIVGILAAIAYPSYIDYVTKSGRAEGVAAVMEVANLQEQYYLDN
RTYASDLTKLGMSANPFVTEHEHYKVASTGGATFKVTATAIGSQASRDTACATITMTDAG
VKGPSKECWK